Structure of PDB 4ut0 Chain K Binding Site BS03

Receptor Information

>4ut0 Chain K (length=178) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAP
LMQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMR
EQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLD
DHRHGVYVLNISLRDRIKFVHTILSSHL

Ligand information

>4ut0 Chain M (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gttccggcgcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4ut0 Visualizing Phosphodiester-Bond Hydrolysis by an Endonuclease.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	G20 D21 G22 Y25 Y29 K30 R33 R37 R77
Binding residue (residue number reindexed from 1)	G16 D17 G18 Y21 Y25 K26 R29 R33 R73

Enzymatic activity

Enzyme Commision number

3.1.-.-

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity

	Biological Process
GO:0006314	intron homing
GO:0016539	intein-mediated protein splicing

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4ut0, PDBe:4ut0, PDBj:4ut0
PDBsum	4ut0
PubMed	25486305
UniProt	P21505\|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]