Structure of PDB 6t83 Chain Jy Binding Site BS03

Receptor Information

>6t83 Chain Jy (length=169) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT
KEDTVSWFKQKYDADVLDK

Ligand information

>6t83 Chain 6b (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uccuuguuagcucaguugguagagcguucggcuuuuaaccgaaaugucag
ggguucgagcccccuaugaggagcca

<<<<<<...<<<<........>>>><<<<<<.......>>>>>.>...<<
<<<.......>>>>>.>>>>>>....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6t83 Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.
Resolution	4.0 Å
Binding residue (original residue number in PDB)	T53 R55 R61
Binding residue (residue number reindexed from 1)	T48 R50 R56

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6t83, PDBe:6t83, PDBj:6t83
PDBsum	6t83
PubMed	31858614
UniProt	P0C0W9\|RL11A_YEAST Large ribosomal subunit protein uL5A (Gene Name=RPL11A)

[Back to BioLiP]