Structure of PDB 6b4v Chain JA Binding Site BS03

Receptor Information
>6b4v Chain JA (length=258) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMS
ASEGEHGGYKEIIAKISGDGVYGRLKFESGGHRVQRVPATESQGRIHTSA
CTVAVMPELPDAELPDINPADLRIDTFRSSGAGGQHVNTTDSAIRITHLP
TGIVVECQDERSQHKNKAKALSVLGARIHAAEMAKRQQAEASTRRNLLGS
GDRSDRNRTYNFPQGRVTDHRINLTLYRLDEVMEGKLDMLIEPIIQEHQA
DQLAALSE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b4v Mechanism of Inhibition of Translation Termination by Blasticidin S.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		G120 G121 D122 E123 T190 G194 R195 I196 H197 T198
Binding residue
(residue number reindexed from 1)		G20 G21 D22 E23 T90 G94 R95 I96 H97 T98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003747 translation release factor activity
GO:0005515 protein binding
GO:0016149 translation release factor activity, codon specific
GO:0043022 ribosome binding
Biological Process
GO:0006412 translation
GO:0006415 translational termination
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6b4v, PDBe:6b4v, PDBj:6b4v
PDBsum6b4v
PubMed29366636
UniProtP0A7I0|RF1_ECOLI Peptide chain release factor RF1 (Gene Name=prfA)

[Back to BioLiP]