Structure of PDB 7ukh Chain J Binding Site BS03

Receptor Information
>7ukh Chain J (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQG
DSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYD
LNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRN
KDGVVTIEEFIESCQKDENIMRSMQLFDNVI
Ligand information
Ligand IDCA
InChIInChI=1S/Ca/q+2
InChIKeyBHPQYMZQTOCNFJ-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Ca++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Ca+2]
FormulaCa
NameCALCIUM ION
ChEMBL
DrugBankDB14577
ZINC
PDB chain7ukh Chain J Residue 903 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ukh Activation and closed-state inactivation mechanisms of the human voltage-gated K V 4 channel complexes.
Resolution2.33 Å
Binding residue
(original residue number in PDB)		D219 N221 D223 V225 E230
Binding residue
(residue number reindexed from 1)		D148 N150 D152 V154 E159
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005250 A-type (transient outward) potassium channel activity
GO:0005267 potassium channel activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0015459 potassium channel regulator activity
GO:0044325 transmembrane transporter binding
GO:0044877 protein-containing complex binding
GO:0046872 metal ion binding
GO:0046923 ER retention sequence binding
Biological Process
GO:0001508 action potential
GO:0005513 detection of calcium ion
GO:0006813 potassium ion transport
GO:0006936 muscle contraction
GO:0007165 signal transduction
GO:0007268 chemical synaptic transmission
GO:0008016 regulation of heart contraction
GO:0045163 clustering of voltage-gated potassium channels
GO:0060306 regulation of membrane repolarization
GO:0071805 potassium ion transmembrane transport
GO:0086009 membrane repolarization
GO:0086013 membrane repolarization during cardiac muscle cell action potential
GO:1901379 regulation of potassium ion transmembrane transport
GO:1903764 regulation of potassium ion export across plasma membrane
GO:1903766 positive regulation of potassium ion export across plasma membrane
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0008076 voltage-gated potassium channel complex
GO:0030425 dendrite
GO:0034702 monoatomic ion channel complex
GO:0045202 synapse
GO:0071193 Kv4.2-KChIP2 channel complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ukh, PDBe:7ukh, PDBj:7ukh
PDBsum7ukh
PubMed35597238
UniProtQ9NS61|KCIP2_HUMAN A-type potassium channel modulatory protein KCNIP2 (Gene Name=KCNIP2)

[Back to BioLiP]