Structure of PDB 5ef6 Chain J Binding Site BS03

Receptor Information
>5ef6 Chain J (length=62) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQN
RRVKEKKVLAKV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ef6 Impact of cytosine methylation on DNA binding specificities of human transcription factors.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R220 P222 F240 K243 R246 Q265 R268
Binding residue
(residue number reindexed from 1)		R4 P6 F24 K27 R30 Q49 R52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5ef6, PDBe:5ef6, PDBj:5ef6
PDBsum5ef6
PubMed28473536
UniProtQ92826|HXB13_HUMAN Homeobox protein Hox-B13 (Gene Name=HOXB13)

[Back to BioLiP]