Structure of PDB 4xqn Chain J Binding Site BS03

Receptor Information
>4xqn Chain J (length=98) Species: 93062 (Staphylococcus aureus subsp. aureus COL) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELS
QLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xqn Conformational features of theStaphylococcus aureusAgrA-promoter interactions rationalize quorum-sensing triggered gene expression.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		S164 H169 N185 L186 K187 N201 S202
Binding residue
(residue number reindexed from 1)		S24 H29 N45 L46 K47 N61 S62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000156 phosphorelay response regulator activity
GO:0003677 DNA binding

View graph for
Molecular Function
External links
PDB RCSB:4xqn, PDBe:4xqn, PDBj:4xqn
PDBsum4xqn
PubMed28955870
UniProtQ5HEG2|AGRA_STAAC Accessory gene regulator A (Gene Name=agrA)

[Back to BioLiP]