Structure of PDB 8w2r Chain I Binding Site BS03

Receptor Information
>8w2r Chain I (length=258) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHG
QVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLL
KLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIE
SMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVD
IIATDIQTKELQKQITKIQNFRVYYRGPAKLLWKGEGAVVIQDNSDIKVV
PRRKAKII
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8w2r HIV-1 integrase assembles multiple species of stable synaptic complex intasomes that are active for concerted DNA integration in vitro.
Resolution3.23 Å
Binding residue
(original residue number in PDB)		H51 G52 Q53 V54 G140 I141 N144 Q146 S147 G149 S153 M154
Binding residue
(residue number reindexed from 1)		H49 G50 Q51 V52 G138 I139 N142 Q144 S145 G147 S151 M152
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding
Biological Process
GO:0015074 DNA integration

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8w2r, PDBe:8w2r, PDBj:8w2r
PDBsum8w2r
PubMed38582148
UniProtP12497|POL_HV1N5 Gag-Pol polyprotein (Gene Name=gag-pol)

[Back to BioLiP]