Structure of PDB 3j7r Chain I Binding Site BS03

Receptor Information
>3j7r Chain I (length=213) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLGGH
MVSDEYEQLSSEALEAARICANKYMVKSCGRDGFHMRVRLHPFHVIRINK
MLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNEEHVIEA
LRRAKFKFPGRQKIHISKKWGFTKFNADEFENMVAKKCLIPDGCGVKYVP
NHGPLDKWRVLHS
Ligand information
>3j7r Chain S5 (length=74) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggauagcucaggguagagcaggggauugaaaauccccguguccuug
guucgauuccgaguccgggcacca
.<<<<<<.................<<<<<<.....>>>>>>......<<<
<.......>>>>.>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3j7r Structure of the Mammalian ribosome-sec61 complex to 3.4 a resolution.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		D28 S104 C105
Binding residue
(residue number reindexed from 1)		D27 S103 C104
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0045182 translation regulator activity
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
GO:0006417 regulation of translation
GO:1990403 embryonic brain development
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j7r, PDBe:3j7r, PDBj:3j7r
PDBsum3j7r
PubMed24930395
UniProtQ29195|RL10_PIG Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]