Structure of PDB 1c9b Chain I Binding Site BS03

Receptor Information
>1c9b Chain I (length=207) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAI
ASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLI
TTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIY
MASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTP
VDKLPQL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1c9b Structural basis of preinitiation complex assembly on human pol II promoters.
Resolution2.65 Å
Binding residue
(original residue number in PDB)		K152 G153 R154 K178 K189 R193 G247 R248 S249 S252 V280 A281 T284
Binding residue
(residue number reindexed from 1)		K43 G44 R45 K69 K80 R84 G138 R139 S140 S143 V171 A172 T175
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0017025 TBP-class protein binding
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0070897 transcription preinitiation complex assembly

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1c9b, PDBe:1c9b, PDBj:1c9b
PDBsum1c9b
PubMed10619841
UniProtQ00403|TF2B_HUMAN Transcription initiation factor IIB (Gene Name=GTF2B)

[Back to BioLiP]