Structure of PDB 8q3m Chain HHH Binding Site BS03

Receptor Information
>8q3m Chain HHH (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>8q3m Chain MMM (length=14) Species: 37296 (Human gammaherpesvirus 8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PGPRLRSGRSTGAP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q3m Viral peptide conjugates for metal-warhead delivery to chromatin.
Resolution2.503 Å
Binding residue
(original residue number in PDB)		Q44 V45 L103 H106 E110 K113
Binding residue
(residue number reindexed from 1)		Q17 V18 L76 H79 E83 K86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8q3m, PDBe:8q3m, PDBj:8q3m
PDBsum8q3m
PubMed38495982
UniProtO60814|H2B1K_HUMAN Histone H2B type 1-K (Gene Name=H2BC12)

[Back to BioLiP]