Structure of PDB 7m50 Chain HH Binding Site BS03

Receptor Information
>7m50 Chain HH (length=144) Species: 12881 (Satellite tobacco mosaic virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSLFSANF
RTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASN
INTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7m50 Structures of additional crystal forms of Satellite tobacco mosaic virus grown from a variety of salts.
Resolution2.31 Å
Binding residue
(original residue number in PDB)		T36 V38
Binding residue
(residue number reindexed from 1)		T21 V23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
Cellular Component
GO:0019028 viral capsid

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7m50, PDBe:7m50, PDBj:7m50
PDBsum7m50
PubMed34866603
UniProtP17574|COAT_STMV Coat protein

[Back to BioLiP]