Structure of PDB 9fh9 Chain H Binding Site BS03

Receptor Information
>9fh9 Chain H (length=92) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
>9fh9 Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcggatgtatatatctgacacgtgcctggagactagggagtaatcccctt
ggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9fh9 Real-space refinement in PHENIX for cryo-EM and crystallography.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y39 S52 S53 R83 S84 T85
Binding residue
(residue number reindexed from 1)		Y10 S23 S24 R54 S55 T56
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:9fh9, PDBe:9fh9, PDBj:9fh9
PDBsum9fh9
PubMed39143240
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]