Structure of PDB 8ovj Chain H Binding Site BS03

Receptor Information
>8ovj Chain H (length=220) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FPSRKDAFRAQRKGAKKHRPEIIVIDLKDHVLGRAAAVVAKQLLLGKKIT
VVRCEQLNIAGTEIRNKIKYLQYLRKRKLTNPTKGPFHHRAPSDVFVRTV
RSMLPRYTKRGMKALNSLVAYEGIPPNVVRTGGRVVIPRAQRHVCYRSER
PYTVLGNMCKHVGWKYSDVVANLEKARVEKASRHHEKQAKLRDAWKSARK
EALAKMPKHNVEVLKKFGYA
Ligand information
>8ovj Chain 6 (length=71) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aucgaaucgccaccuacaagacuggagcuugcucccucgaaggcgccaag
uauauucaugaucacaagaca
......<.<<<............<<<<<..>>>>>......>>>......
..................>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R11 R14 K30 R55 V131 G134 G135 R136 R179 H187 W197 R201 H211 G220
Binding residue
(residue number reindexed from 1)		R9 R12 K28 R53 V129 G132 G133 R134 R177 H185 W195 R199 H209 G218
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
PDBsum8ovj
PubMed38722744
UniProtQ4QFG2

[Back to BioLiP]