Structure of PDB 8hni Chain H Binding Site BS03

Receptor Information
>8hni Chain H (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
REKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGF
GFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKL
FVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHD
PVDKIVLQKYHTINGHNAEVRKALSRQEM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hni Structural Insight Into hnRNP A2/B1 Homodimerization and DNA Recognition.
Resolution2.644 Å
Binding residue
(original residue number in PDB)
K22 F24 G26 G27 L28 F30 D49 V51 M53 R62 F64 F66 R89 E92 K94 A96 V97 R99 H108
Binding residue
(residue number reindexed from 1)
K8 F10 G12 G13 L14 F16 D35 V37 M39 R48 F50 F52 R75 E78 K80 A82 V83 R85 H94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:8hni, PDBe:8hni, PDBj:8hni
PDBsum8hni
PubMed36528084
UniProtP22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 (Gene Name=HNRNPA2B1)

[Back to BioLiP]