Structure of PDB 6az3 Chain H Binding Site BS03

Receptor Information
>6az3 Chain H (length=221) Species: 5661 (Leishmania donovani) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFPSRKDASRAQRKSAKKHRPEIIVIDLKDHVLGRAAAVVAKQLLLGKKI
TVVRCEQLNIAGTEIRNKIKYLQYLRKRKLTNPTKGPFHHRAPSDVFVRT
VRSMLPRYTKRGMKALNSLVAYEGIPPNVVRTGGRVVIPRAQRHVCYRSE
RPYTVLGNMCKHVGWKYSDVVANLEKARVEKASRHHEKQAKLREAWKAAR
KEALAKMPKHNVEVLKKFGYA
Ligand information
>6az3 Chain 4 (length=183) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugagauugugaagggaucucgcagguaucgugagggaaguaugggguag
uacgagaggaacucccaugccgugccucuaguuucugggguuugucgaac
ggcaagugccccgaagccaucgcacggugguucucggcugaacgccucua
agccagaagccaaucccaagaccagaugcccac
<<<<<<<.........>>>>>>>.<<<<<<....<<<<.<<<<<<<<...
............>>>>>>>><<<<<...<.<<....<<<<<<<<<.....
.>>>>..>>>>>...>>.>..>>>>>.<<<<....<<<<...........
>>>>....>>>>.>>>>.......>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6az3 Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		A2 F3 P4 S5 R6 S10 R79 P84 H90 H91 R92 H163 V164 K167 Y168
Binding residue
(residue number reindexed from 1)		A1 F2 P3 S4 R5 S9 R78 P83 H89 H90 R91 H162 V163 K166 Y167
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 04:42:48 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6az3', asym_id = 'H', bs = 'BS03', title = 'Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6az3', asym_id='H', bs='BS03', title='Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0015934', uniprot = '', pdbid = '6az3', asym_id = 'H'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0015934', uniprot='', pdbid='6az3', asym_id='H')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>