Structure of PDB 5e5a Chain H Binding Site BS03

Receptor Information
>5e5a Chain H (length=94) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
>5e5a Chain K (length=14) Species: 10363 (Human herpesvirus 5 strain Towne) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GKSTHPMVTRSKAD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5e5a Human cytomegalovirus IE1 protein alters the higher-order chromatin structure by targeting the acidic patch of the nucleosome
Resolution2.809 Å
Binding residue
(original residue number in PDB)		Q44 V45 L103 H106 E110
Binding residue
(residue number reindexed from 1)		Q17 V18 L76 H79 E83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5e5a, PDBe:5e5a, PDBj:5e5a
PDBsum5e5a
PubMed26812545
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]