Structure of PDB 1hwt Chain H Binding Site BS03

Receptor Information
>1hwt Chain H (length=73) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAE
KELLKDNELKKLRERVKSLEKTL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hwt Structure of a HAP1-DNA complex reveals dramatically asymmetric DNA binding by a homodimeric protein.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		K56 R57 R59 P61 S63 R68 K71 K73 C74
Binding residue
(residue number reindexed from 1)		K1 R2 R4 P6 S8 R13 K16 K18 C19
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1hwt, PDBe:1hwt, PDBj:1hwt
PDBsum1hwt
PubMed9886294
UniProtP0CS82|HAP1_YEASX Heme-responsive zinc finger transcription factor HAP1 (Gene Name=HAP1)

[Back to BioLiP]