Structure of PDB 9fh9 Chain G Binding Site BS03

Receptor Information
>9fh9 Chain G (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEIL
ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQA
VLLP
Ligand information
>9fh9 Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcggatgtatatatctgacacgtgcctggagactagggagtaatcccctt
ggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9fh9 Real-space refinement in PHENIX for cryo-EM and crystallography.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		K15 R17 R32 R77
Binding residue
(residue number reindexed from 1)		K2 R4 R19 R64
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0031492 nucleosomal DNA binding
Biological Process
GO:0006337 nucleosome disassembly
GO:0031507 heterochromatin formation
GO:0070914 UV-damage excision repair
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9fh9, PDBe:9fh9, PDBj:9fh9
PDBsum9fh9
PubMed39143240
UniProtQ7L7L0|H2A3_HUMAN Histone H2A type 3 (Gene Name=H2AC25)

[Back to BioLiP]