Structure of PDB 8v87 Chain G Binding Site BS03

Receptor Information
>8v87 Chain G (length=198) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSRYVKWPEYVRVQRQKKILSIRLKVPPTIAQFQYTLDRNTAAETFKLFN
KYRPETAAEKKERLTKEAAAVAEGASPKPYAVKYGLNHVVALIENKKAKL
VLIANDVDPIELVVFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAAL
TEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGNKAQAKMDK
Ligand information
>8v87 Chain 6 (length=87) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccuucucaaacauucuguuugguagugagugauacucuuuggaguuaacu
ugaaauugcuggccuuuaggcgaacaauguucuuaaa
......<<<<<<...>>>>>>.....<<<<.<.<<<<....>>>>>.>>>
>..........<<<<..>>>>................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8v87 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.
Resolution2.66 Å
Binding residue
(original residue number in PDB)		N85 E89 A212 K213 S216
Binding residue
(residue number reindexed from 1)		N40 E44 A162 K163 S166
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000470 maturation of LSU-rRNA
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8v87, PDBe:8v87, PDBj:8v87
PDBsum8v87
PubMed38632236
UniProtP17076|RL8A_YEAST Large ribosomal subunit protein eL8A (Gene Name=RPL8A)

[Back to BioLiP]