Structure of PDB 8jzf Chain G Binding Site BS03

Receptor Information

>8jzf Chain G (length=217) Species: 2949 (Symbiodinium)

AAAAAAAAAAHPKHMLVAGVRGYEMEWQPIPGDAVKYPKPNSEEMFKTMI
GADVETGGEAWDPLGFHKLFDRNFDFNMLPVYPHVQWLREAEIKHGRVCM
LAFIGCFAQAGYHIGVQPDWSKALAECYASPTGAVGLFQISVLIGWIEGK
NYNGDAWVGMSEKEPGDLGFDPAGFTKNPDFDLKKAQLQEIKNGRLAMVG
CASIAANHFIPGSVPLL

Ligand information

• Ligand ID: DD6
• InChI: InChI=1S/C40H54O3/c1-29(17-13-19-31(3)21-22-36-33(5)25-34(41)26-37(36,6)7)15-11-12-16-30(2)18-14-20-32(4)23-24-40-38(8,9)27-35(42)28-39(40,10)43-40/h11-20,23-24,34-35,41-42H,25-28H2,1-10H3/b12-11+,17-13+,18-14+,24-23-,29-15+,30-16+,31-19+,32-20+/t34-,35+,39-,40+/m1/s1
• InChIKey: OGHZCSINIMWCSB-WMTIXGNLSA-N
• SMILES:
  ACDLabs 12.01: CC([C@H]=C[C@H]=C(C#CC=1C(C)(C)CC(CC=1C)O)C)=[C@H]C=[C@H]\C=C(/C)\C=C\C=C(/C)\C=C/C32OC2(CC(CC3(C)C)O)C
  OpenEye OEToolkits 2.0.6: CC1=C(C(CC(C1)O)(C)C)C#CC(=CC=CC(=CC=CC=C(C)C=CC=C(C)C=CC23C(CC(CC2(O3)C)O)(C)C)C)C
  CACTVS 3.385: CC1=C(C#CC(\C)=C\C=C\C(C)=C\C=C\C=C(C)\C=C\C=C(C)\C=C/[C@@]23O[C@]2(C)C[C@@H](O)CC3(C)C)C(C)(C)C[C@H](O)C1
  OpenEye OEToolkits 2.0.6: CC1=C(C(C[C@@H](C1)O)(C)C)C#C/C(=C/C=C/C(=C/C=C/C=C(\C)/C=C/C=C(\C)/C=C\[C@]23[C@](O2)(C[C@H](CC3(C)C)O)C)/C)/C
  CACTVS 3.385: CC1=C(C#CC(C)=CC=CC(C)=CC=CC=C(C)C=CC=C(C)C=C[C]23O[C]2(C)C[CH](O)CC3(C)C)C(C)(C)C[CH](O)C1
• Formula: C40 H54 O3
• Name: (3S,3'R,5R,6S,7cis)-7',8'-didehydro-5,6-dihydro-5,6-epoxy-beta,beta-carotene-3,3'-diol;
  Diadinoxanthin
• PDB chain: 8jzf Chain G Residue 504

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8jzf Structures and organizations of PSI-AcpPCI supercomplexes from red tidal and coral symbiotic photosynthetic dinoflagellates.
• Resolution: 2.7 Å
• Binding residue (original residue number in PDB): D62 P63 L64 F66 H95 V98 C99 A102 Q109 W123 M201
• Binding residue (residue number reindexed from 1): D62 P63 L64 F66 H95 V98 C99 A102 Q109 W120 M198
• Annotation score: 1

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Nov 27 16:39:51 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8jzf', asym_id = 'G', bs = 'BS03', title = 'Structures and organizations of PSI-AcpPCI super...d coral symbiotic photosynthetic dinoflagellates.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8jzf', asym_id='G', bs='BS03', title='Structures and organizations of PSI-AcpPCI super...d coral symbiotic photosynthetic dinoflagellates.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0009765,0016020', uniprot = '', pdbid = '8jzf', asym_id = 'G'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009765,0016020', uniprot='', pdbid='8jzf', asym_id='G')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>