Structure of PDB 8h9h Chain G Binding Site BS03

Receptor Information
>8h9h Chain G (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHM
RKHTGEKPYLCQQCGAAFAHNYDLKNHMRVH
Ligand information
>8h9h Chain F (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KPYLCQQCGAAFAHNYDLKNHMRVH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h9h ZBTB7A regulates primed-to-naive transition of pluripotent stem cells via recognition of the PNT-associated sequence by zinc fingers 1-2 and recognition of gamma-globin -200 gene element by zinc fingers 1-4.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Q382 P385 I401
Binding residue
(residue number reindexed from 1)		Q3 P6 I22
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8h9h, PDBe:8h9h, PDBj:8h9h
PDBsum8h9h
PubMed37013936
UniProtO95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)

[Back to BioLiP]