Structure of PDB 8euy Chain G Binding Site BS03

Receptor Information
>8euy Chain G (length=164) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LKVPPAIAQFQKTLDKNTATQVFKLLNKYRPETAAEKKQRLVAEAEAVAN
GKVSKKPYNVKYGLNHVVALIEAKKAKLVLIASDVDPIELVVFLPALCKK
MGVPYAIVKNKARLGTVIHQKTAAVLAVTEVREEDKNELASIVSAVDANF
SAKYDESRRKWGGG
Ligand information
>8euy Chain 6 (length=56) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acaaucuucucacauguuuuuuuuuaaauauuuuugagaaaauuuguuuu
uuuuuu
...........<<..>>...............<.......>.........
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8euy Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Q89 K92
Binding residue
(residue number reindexed from 1)		Q21 K24
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000470 maturation of LSU-rRNA
GO:0002181 cytoplasmic translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8euy, PDBe:8euy, PDBj:8euy
PDBsum8euy
PubMed36423630
UniProtO13672|RL8_SCHPO Large ribosomal subunit protein eL8 (Gene Name=rpl8)

[Back to BioLiP]