Structure of PDB 7yqk Chain G Binding Site BS03

Receptor Information
>7yqk Chain G (length=111) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARAKACTRSSRAGLQFPVGRVHRLLRKGHYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLP
NIQAVLLPKKT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yqk Chemical Synthesis of Post-Translationally Modified H2AX Reveals Redundancy in Interplay between Histone Phosphorylation, Ubiquitination, and Methylation on the Binding of 53BP1 with Nucleosomes.
Resolution3.38 Å
Binding residue
(original residue number in PDB)		Y57 E61
Binding residue
(residue number reindexed from 1)		Y48 E52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7yqk, PDBe:7yqk, PDBj:7yqk
PDBsum7yqk
PubMed36166692
UniProtP16104|H2AX_HUMAN Histone H2AX (Gene Name=H2AX)

[Back to BioLiP]