Structure of PDB 7uqb Chain G Binding Site BS03

Receptor Information

>7uqb Chain G (length=224) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRVQRQKKILSIRLKVPP
TIAQFQYTLDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAVSPKPYAV
KYGLNHVVALIENKKAKLVLIANDVDPIELVVFLPALCKKMGVPYAIVKG
KARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKH
WGGGILGNKAQAKMDKRAKNSDSA

Ligand information

>7uqb Chain 6 (length=58) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ccuucucaaacauguuugguagugagugauacucgaguuaacuugaaauu
gccuuaaa

......<<<<<..>>>>>.....<<<<.<.<<<..>>>>.>>>>......
........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7uqb rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.
Resolution	2.43 Å
Binding residue (original residue number in PDB)	N85 E89 K92 A212 K213 S216
Binding residue (residue number reindexed from 1)	N62 E66 K69 A180 K181 S184

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000470	maturation of LSU-rRNA
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7uqb, PDBe:7uqb, PDBj:7uqb
PDBsum	7uqb
PubMed	36864048
UniProt	P17076\|RL8A_YEAST Large ribosomal subunit protein eL8A (Gene Name=RPL8A)

[Back to BioLiP]