Structure of PDB 7ohs Chain G Binding Site BS03

Receptor Information

>7ohs Chain G (length=158) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KVPPTIAQFQYTLDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAVAEG
SPKPYAVKYGLNHVVALIENKKAKLVLIANDVDPIELVVFLPALCKKMGV
PYAIVKGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADK
YDEVKKHW

Ligand information

>7ohs Chain 6 (length=65) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ccuucucaaacauucuguuugguagugagugauacucuuuggaguuaacu
ugaaauugccuuaaa

......<<<<<<...>>>>>>.....<<<<...<<<<....>>>>..>>>
>..............

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7ohs Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
Resolution	4.38 Å
Binding residue (original residue number in PDB)	N85 E89 K213 S216
Binding residue (residue number reindexed from 1)	N16 E20 K138 S141

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000470	maturation of LSU-rRNA
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ohs, PDBe:7ohs, PDBj:7ohs
PDBsum	7ohs
PubMed	34813592
UniProt	P17076\|RL8A_YEAST Large ribosomal subunit protein eL8A (Gene Name=RPL8A)

[Back to BioLiP]