Structure of PDB 7eyi Chain G Binding Site BS03

Receptor Information

>7eyi Chain G (length=111) Species: 9606 (Homo sapiens)

HMQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHM
RKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSD
HLHRHLKKDGC

Ligand information

>7eyi Chain C (length=18)

atagggccccttcccaac

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7eyi Structural basis for human ZBTB7A action at the fetal globin promoter.
• Resolution: 2.401 Å
• Binding residue (original residue number in PDB): K486 K487
• Binding residue (residue number reindexed from 1): K107 K108

External links

• PDB: RCSB:7eyi, PDBe:7eyi, PDBj:7eyi
• PDBsum: 7eyi
• PubMed: 34592153
• UniProt: O95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)