Structure of PDB 6sef Chain G Binding Site BS03

Receptor Information
>6sef Chain G (length=103) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPN
IQA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sef CENP-C unwraps the human CENP-A nucleosome through the H2A C-terminal tail.
Resolution3.7 Å
Binding residue
(original residue number in PDB)
E61 D90 E91
Binding residue
(residue number reindexed from 1)
E51 D80 E81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6sef, PDBe:6sef, PDBj:6sef
PDBsum6sef
PubMed31475439
UniProtQ6FI13|H2A2A_HUMAN Histone H2A type 2-A (Gene Name=H2AC18)

[Back to BioLiP]