Structure of PDB 6lc1 Chain G Binding Site BS03

Receptor Information
>6lc1 Chain G (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRR
RNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lc1 Structural basis of NR4A1 bound to the human pituitary proopiomelanocortin gene promoter.
Resolution3.12 Å
Binding residue
(original residue number in PDB)		D340 S341
Binding residue
(residue number reindexed from 1)		D75 S76
Binding affinityPDBbind-CN: Kd=135.33nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6lc1, PDBe:6lc1, PDBj:6lc1
PDBsum6lc1
PubMed31822342
UniProtP22736|NR4A1_HUMAN Nuclear receptor subfamily 4immunitygroup A member 1 (Gene Name=NR4A1)

[Back to BioLiP]