Structure of PDB 5lj5 Chain G Binding Site BS03

Receptor Information
>5lj5 Chain G (length=97) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSRNVDKANSVLVRFQEQQAESAGGYKDYSRYQRPRNVSKVKSIKEANEW
KRQVSKEIKQKSTRIYDPSLNEMQIAELNDELNNLFKEWKRWQWHID
Ligand information
>5lj5 Chain V (length=97) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guucgcgaagcuucguggacauuuggucaauuugaaacaauacagagaug
aucagcaguuccccugcauaaggaugaaccguuuuacaaagagauuu
<<<<<<<<<..>>>>>>>>>..............................
.......<<<..<<<.....>>>...>>>..................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lj5 Cryo-EM structure of the spliceosome immediately after branching.
Resolution10.0 Å
Binding residue
(original residue number in PDB)		N4 S30 R31 Q60
Binding residue
(residue number reindexed from 1)		N4 S30 R31 Q60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000384 first spliceosomal transesterification activity
GO:0005515 protein binding
Biological Process
GO:0000350 generation of catalytic spliceosome for second transesterification step
GO:0000389 mRNA 3'-splice site recognition
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0071014 post-mRNA release spliceosomal complex
GO:0071020 post-spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lj5, PDBe:5lj5, PDBj:5lj5
PDBsum5lj5
PubMed27459055
UniProtP21374|ISY1_YEAST Pre-mRNA-splicing factor ISY1 (Gene Name=ISY1)

[Back to BioLiP]