Structure of PDB 5gtc Chain G Binding Site BS03

Receptor Information
>5gtc Chain G (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAE
ILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNI
QAVLLPK
Ligand information
>5gtc Chain K (length=11) Species: 37296 (Human gammaherpesvirus 8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GMRLRSGRSTG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gtc Synthetic Posttranslational Modifications: Chemical Catalyst-Driven Regioselective Histone Acylation of Native Chromatin.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		E56 Y57 E61 E64 D90 E92
Binding residue
(residue number reindexed from 1)		E45 Y46 E50 E53 D79 E81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0008285 negative regulation of cell population proliferation
GO:0031507 heterochromatin formation
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0043505 CENP-A containing nucleosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gtc, PDBe:5gtc, PDBj:5gtc
PDBsum5gtc
PubMed28534629
UniProtP04908|H2A1B_HUMAN Histone H2A type 1-B/E (Gene Name=H2AC4)

[Back to BioLiP]