Structure of PDB 5e5a Chain G Binding Site BS03

Receptor Information
>5e5a Chain G (length=105) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEIL
ELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQS
VLLPK
Ligand information
>5e5a Chain K (length=14) Species: 10363 (Human herpesvirus 5 strain Towne) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GKSTHPMVTRSKAD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5e5a Human cytomegalovirus IE1 protein alters the higher-order chromatin structure by targeting the acidic patch of the nucleosome
Resolution2.809 Å
Binding residue
(original residue number in PDB)		E56 Y57 E61 E64 D90 E92
Binding residue
(residue number reindexed from 1)		E43 Y44 E48 E51 D77 E79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5e5a, PDBe:5e5a, PDBj:5e5a
PDBsum5e5a
PubMed26812545
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]