Structure of PDB 5a0w Chain G Binding Site BS03

Receptor Information
>5a0w Chain G (length=178) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAP
LMQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMR
EQIAFIKGLYVAAGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLD
DHRHGVYVLNISLRDRIKFVHTILSSHL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5a0w Structural and Dynamical Characterization of the I- Dmo Catalytic Activity
Resolution2.2 Å
Binding residue
(original residue number in PDB)		N32 R33 S34 E35 Y36 R37 S67 K68 Q70 R81 S83 S84 K85 A116 G118 D119 K120 R126 W128 H158
Binding residue
(residue number reindexed from 1)		N28 R29 S30 E31 Y32 R33 S63 K64 Q66 R77 S79 S80 K81 A112 G114 D115 K116 R122 W124 H154
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
GO:0016539 intein-mediated protein splicing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5a0w, PDBe:5a0w, PDBj:5a0w
PDBsum5a0w
PubMed
UniProtP21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]