Structure of PDB 3dm1 Chain G Binding Site BS03

Receptor Information
>3dm1 Chain G (length=53) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLN
SQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dm1 Structural basis of the chromodomain of Cbx3 bound to methylated peptides from histone h1 and G9a.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		E29 F30 V31 V32 W51 F54 E62 N66 D68
Binding residue
(residue number reindexed from 1)		E1 F2 V3 V4 W23 F26 E34 N38 D40
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3dm1, PDBe:3dm1, PDBj:3dm1
PDBsum3dm1
PubMed22514736
UniProtQ13185|CBX3_HUMAN Chromobox protein homolog 3 (Gene Name=CBX3)

[Back to BioLiP]