Structure of PDB 1zla Chain G Binding Site BS03

Receptor Information
>1zla Chain G (length=106) Species: 263730 (Expression vector pET3-H2A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEIL
ELAGNWERDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQS
VLLPKK
Ligand information
>1zla Chain K (length=14) Species: 37296 (Human gammaherpesvirus 8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PGMRLRSGRSTGAP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zla The nucleosomal surface as a docking station for Kaposi's sarcoma herpesvirus LANA.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		Y1057 E1061 E1064 D1090 E1092
Binding residue
(residue number reindexed from 1)		Y44 E48 E51 D77 E79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1zla, PDBe:1zla, PDBj:1zla
PDBsum1zla
PubMed16469929
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]