Structure of PDB 6uu5 Chain FFF Binding Site BS03

Receptor Information
>6uu5 Chain FFF (length=277) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLV
VKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQ
TIERAIMNQTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQL
DKPVDDVSRMLRLNERITSVDTPLGGDSEKALLDILADEKENGPEDTTQD
DDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERV
RQIQVEGLRRLREILQTQGLNIEALFL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uu5 Structural Insights into Transcription Initiation from De Novo RNA Synthesis to Transitioning into Elongation.
Resolution5.403 Å
Binding residue
(original residue number in PDB)		G227 G228 D229 E231
Binding residue
(residue number reindexed from 1)		G175 G176 D177 E179
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001000 bacterial-type RNA polymerase core enzyme binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress
GO:0010468 regulation of gene expression
GO:0045892 negative regulation of DNA-templated transcription
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0000345 cytosolic DNA-directed RNA polymerase complex
GO:0005737 cytoplasm
GO:1903865 sigma factor antagonist complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6uu5, PDBe:6uu5, PDBj:6uu5
PDBsum6uu5
PubMed32829286
UniProtP13445|RPOS_ECOLI RNA polymerase sigma factor RpoS (Gene Name=rpoS)

[Back to BioLiP]