Structure of PDB 7a5k Chain F6 Binding Site BS03

Receptor Information
>7a5k Chain F6 (length=201) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRYSPEFKDPLIDKEYYRKEEKYVRELKKTQLIKAAPAGKTSSVFEDPVI
SKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNP
YTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITEC
RDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANRALAHYRW
W
Ligand information
>7a5k Chain FE (length=73) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaauguagcuuaaauuaucaaagcaaggcacugaaaaugccuagauga
gccucacagcuccauuaacacca
<<<<<<<...................<............>........<.
.........>..>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a5k Elongational stalling activates mitoribosome-associated quality control.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		L158 V159 P160 I161 L162 G165 R166 F167 Y168 Q169 V170 K228 M229 E231 A232 N233
Binding residue
(residue number reindexed from 1)		L117 V118 P119 I120 L121 G124 R125 F126 Y127 Q128 V129 K187 M188 E190 A191 N192
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a5k, PDBe:7a5k, PDBj:7a5k
PDBsum7a5k
PubMed33243891
UniProtQ9Y2R9|RT07_HUMAN Small ribosomal subunit protein uS7m (Gene Name=MRPS7)

[Back to BioLiP]