Structure of PDB 7a5f Chain F6 Binding Site BS03

Receptor Information
>7a5f Chain F6 (length=201) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRYSPEFKDPLIDKEYYRKEEKYVRELKKTQLIKAAPAGKTSSVFEDPVI
SKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNP
YTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITEC
RDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANRALAHYRW
W
Ligand information
>7a5f Chain C (length=73) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaauguagcuuaaauuaucaaagcaaggcacugaaaaugccuagauga
gccucacagcuccauuaacacca
<<<<<<<.................<................>........
............>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a5f Elongational stalling activates mitoribosome-associated quality control.
Resolution4.4 Å
Binding residue
(original residue number in PDB)
P160 R166 F167 D225 K228 M229
Binding residue
(residue number reindexed from 1)
P119 R125 F126 D184 K187 M188
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7a5f, PDBe:7a5f, PDBj:7a5f
PDBsum7a5f
PubMed33243891
UniProtQ9Y2R9|RT07_HUMAN Small ribosomal subunit protein uS7m (Gene Name=MRPS7)

[Back to BioLiP]