Structure of PDB 8cuc Chain F Binding Site BS03

Receptor Information
>8cuc Chain F (length=54) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KQHGCTRCGKNFSSASALQIHERTHTGEKPFVCNICGRAFTTKGNLKVHY
MTHG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cuc Crystal Structure Analysis of SALL4 Zinc Finger domain in complex with DNA
Resolution2.09 Å
Binding residue
(original residue number in PDB)
K910 K914 Y917
Binding residue
(residue number reindexed from 1)
K43 K47 Y50
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8cuc, PDBe:8cuc, PDBj:8cuc
PDBsum8cuc
PubMed
UniProtQ9UJQ4|SALL4_HUMAN Sal-like protein 4 (Gene Name=SALL4)

[Back to BioLiP]