Structure of PDB 7z0s Chain F Binding Site BS03

Receptor Information

>7z0s Chain F (length=164) Species: 83333 (Escherichia coli K-12)

FTFIKKVIKTGTATSSYPLEPIAVDKNFRGKPEQNPQQCIGCAACVNACP
SNALTVETDLATGELAWEFNLGHCIFCGRCEEVCPTAAIKLSQEYELAVW
KKEDFLQQSRFALCNCRVCNRPFAVQKEIDYAIALLKHNGDSRAENHRES
FETCPECKRQKCLV

Ligand information

• Ligand ID: FE
• InChI: InChI=1S/Fe/q+3
• InChIKey: VTLYFUHAOXGGBS-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: [Fe+3]
• Formula: Fe
• Name: FE (III) ION
• DrugBank: DB13949
• PDB chain: 7z0s Chain F Residue 203

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7z0s Structure of the membrane-bound formate hydrogenlyase complex from Escherichia coli.
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): C117 C120 C155 C158
• Binding residue (residue number reindexed from 1): C116 C119 C154 C157
• Annotation score: 1

Gene Ontology

Molecular Function

• GO:0003954 NADH dehydrogenase activity
• GO:0016651 oxidoreductase activity, acting on NAD(P)H
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006007 glucose catabolic process
• GO:0009060 aerobic respiration
• GO:0009061 anaerobic respiration
• GO:0015944 formate oxidation
• GO:0019645 anaerobic electron transport chain

Cellular Component

• GO:0009326 formate dehydrogenase complex
• GO:0016020 membrane

External links

• PDB: RCSB:7z0s, PDBe:7z0s, PDBj:7z0s
• PDBsum: 7z0s
• PubMed: 36104349
• UniProt: P16432|HYCF_ECOLI Formate hydrogenlyase subunit 6 (Gene Name=hycF)