Structure of PDB 7vrj Chain F Binding Site BS03

Receptor Information

>7vrj Chain F (length=49) Species: 553982 (Allochromatium tepidum)

SPDLWKIWLLIDPRRVLIAVFAFLTILGLAIHMILLSTTEFNWLEDGIP

Ligand information

• Ligand ID: CA
• InChI: InChI=1S/Ca/q+2
• InChIKey: BHPQYMZQTOCNFJ-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Ca++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Ca+2]
• Formula: Ca
• Name: CALCIUM ION
• DrugBank: DB14577
• PDB chain: 7vrj Chain F Residue 102

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7vrj A Ca 2+ -binding motif underlies the unusual properties of certain photosynthetic bacterial core light-harvesting complexes.
• Resolution: 2.81 Å
• Binding residue (original residue number in PDB): W44 D47 I49
• Binding residue (residue number reindexed from 1): W43 D46 I48
• Annotation score: 4

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Nov 27 18:36:08 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7vrj', asym_id = 'F', bs = 'BS03', title = 'A Ca 2+ -binding motif underlies the unusual pro...thetic bacterial core light-harvesting complexes.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7vrj', asym_id='F', bs='BS03', title='A Ca 2+ -binding motif underlies the unusual pro...thetic bacterial core light-harvesting complexes.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0016020,0019684,0019866,0030077,0045156', uniprot = '', pdbid = '7vrj', asym_id = 'F'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016020,0019684,0019866,0030077,0045156', uniprot='', pdbid='7vrj', asym_id='F')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>