Structure of PDB 7unr Chain F Binding Site BS03

Receptor Information

>7unr Chain F (length=176) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RLKEIYRKEIAPKLKEELQLANVMEVPRVTKITLNMGLGEAVGDKKIIEN
AVADLEKITGQKPVVTYARKSIAGFKIREGWPIGVKVTLRSDRMYEFLDR
LLSISLPRVRDFRGLNAKSFDGRGNYSMGVKEQIIFPEIDYDKIDALRGL
DITLTTTARTDDEGRALLRAFKFPFR

Ligand information

>7unr Chain B (length=117) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcuugacgaucauagagcguuggaaccaccugaucccuucccgaacucag
aagugaaacgacgcaucgccgaugguaguguggggucuccccaugugaga
guaggucaucgucaagc

<<<<<<<<<<....<<<<<<<<....<<<<<<<.............>>>>
..>>>...>>>>>>.>><<<.......<<<<<<<<...>>>>>>>>....
...>>>.>>>>>>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7unr Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
Resolution	2.9 Å
Binding residue (original residue number in PDB)	N24 M26 Q63 K64 V66 T90 R92
Binding residue (residue number reindexed from 1)	N22 M24 Q61 K62 V64 T88 R90

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7unr, PDBe:7unr, PDBj:7unr
PDBsum	7unr
PubMed
UniProt	Q9HWE7\|RL5_PSEAE Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]