Structure of PDB 6j6q Chain F Binding Site BS03

Receptor Information

>6j6q Chain F (length=161) Species: 559292 (Saccharomyces cerevisiae S288C)

SERKAINKYYPPDYNPLEAEKLSRKMAKKLKTMNKSHASIRLMTPFSMRC
LECNEYIPKSRKFNGKKELLKEKYLDSIKIYRLTISCPRCANSIAFRTDP
GNSDYVMEVGGVRNYLEKRLAKIQQEQEDDEELENLRKKNLEMSQRAEMI
NRSKHAQQEKA

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 6j6q Chain F Residue 300

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6j6q Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
• Resolution: 3.7 Å
• Binding residue (original residue number in PDB): C51 C88
• Binding residue (residue number reindexed from 1): C50 C87
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0000384 first spliceosomal transesterification activity
• GO:0005515 protein binding
• GO:0030620 U2 snRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000349 generation of catalytic spliceosome for first transesterification step
• GO:0000350 generation of catalytic spliceosome for second transesterification step
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0071006 U2-type catalytic step 1 spliceosome
• GO:0071007 U2-type catalytic step 2 spliceosome

External links

• PDB: RCSB:6j6q, PDBe:6j6q, PDBj:6j6q
• PDBsum: 6j6q
• PubMed: 30879786
• UniProt: P28320|YJU2_YEAST Splicing factor YJU2 (Gene Name=YJU2)