Structure of PDB 6htq Chain F Binding Site BS03

Receptor Information
>6htq Chain F (length=176) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NRLKEKYNKEIAPALMTKFNYDSVMQVPKIEKIVINMGVGDAVQNAKAID
SAVEELTFIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLD
KLISVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVTKVRG
MDIVIVTTANTDEEARELLTQVGMPF
Ligand information
>6htq Chain v (length=87) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccgaggugguggaauugguagacacgcuaccuugaggugguagugccca
auagggcuuacggguucaagucccguccucgguacca
<<<<<<<..<<<...........>>><<<<<<.......>>>>>><<<<.
...>>>>..<<<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6htq Structural Basis for Regulation of the Opposing (p)ppGpp Synthetase and Hydrolase within the Stringent Response Orchestrator Rel.
Resolution4.5 Å
Binding residue
(original residue number in PDB)		S73 A75 R78 R80
Binding residue
(residue number reindexed from 1)		S72 A74 R77 R79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6htq, PDBe:6htq, PDBj:6htq
PDBsum6htq
PubMed32937119
UniProtP12877|RL5_BACSU Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]