Structure of PDB 5o61 Chain F Binding Site BS03

Receptor Information
>5o61 Chain F (length=182) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KALPRLKQRYREEIREALQQEFNYANVMQIPGVVKVVVNMGVGDAARDAK
LINGAINDLALITGQKPEVRRARKSIAQFKLREGMPIGARVTLRGDRMWE
FLDRLISIALPRIRDFRGLSPKQFDGTGNYTFGLNEQSMFHEIDVDSIDR
PRGMDITVVTTATNDAEGRALLRALGFPFKEN
Ligand information
>5o61 Chain BW (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggauagcucagucgguagagcaggggauugaaaauccccguguccu
ugguucgauuccgaguccgggcacca
<<<<<<<..<<<<........>>>>.<<<<<<.....>>>>>>.....<<
<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5o61 The Complete Structure of the Mycobacterium smegmatis 70S Ribosome.
Resolution3.31 Å
Binding residue
(original residue number in PDB)		S80 I81 R87
Binding residue
(residue number reindexed from 1)		S75 I76 R82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5o61, PDBe:5o61, PDBj:5o61
PDBsum5o61
PubMed28683309
UniProtA0QSG1|RL5_MYCS2 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]