Structure of PDB 4x23 Chain F Binding Site BS03

Receptor Information
>4x23 Chain F (length=79) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYT
EHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>4x23 Chain V (length=22) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VRRSNRIRLKPLEYWRGERIDY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4x23 A conserved mechanism for centromeric nucleosome recognition by centromere protein CENP-C.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		V60 E63 N64
Binding residue
(residue number reindexed from 1)		V37 E40 N41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:4x23, PDBe:4x23, PDBj:4x23
PDBsum4x23
PubMed23723239
UniProtP84040|H4_DROME Histone H4 (Gene Name=His4)

[Back to BioLiP]