Structure of PDB 2fkz Chain F Binding Site BS03

Receptor Information

>2fkz Chain F (length=155) Species: 354 (Azotobacter vinelandii)

MKGDKIVIQHLNKILGNELIAINQYFLHARMYEDWGLEKLGKHEYHESID
EMKHADKLIKRILFLEGLPNLQELGKLLIGEHTKEMLECDLKLEQAGLPD
LKAAIAYCESVGDYASRELLEDILESEEDHIDWLETQLDLIDKIGLENYL
QSQMD

Ligand information

• Ligand ID: FE2
• InChI: InChI=1S/Fe/q+2
• InChIKey: CWYNVVGOOAEACU-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Fe+2]
  CACTVS 3.341: [Fe++]
• Formula: Fe
• Name: FE (II) ION
• DrugBank: DB14510
• PDB chain: 2fkz Chain F Residue 1601

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2fkz Redox-Dependent Structural Changes in the Azotobacter vinelandii Bacterioferritin: New Insights into the Ferroxidase and Iron Transport Mechanism(,).
• Resolution: 2.0 Å
• Binding residue (original residue number in PDB): E51 E94 E127
• Binding residue (residue number reindexed from 1): E51 E94 E127
• Annotation score: 5

Enzymatic activity

• Enzyme Commision number: 1.16.3.1: ferroxidase.

Gene Ontology

Molecular Function

• GO:0004322 ferroxidase activity
• GO:0005506 iron ion binding
• GO:0008199 ferric iron binding
• GO:0015093 ferrous iron transmembrane transporter activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006826 iron ion transport
• GO:0006879 intracellular iron ion homeostasis
• GO:0006880 intracellular sequestering of iron ion
• GO:0034755 iron ion transmembrane transport

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:2fkz, PDBe:2fkz, PDBj:2fkz
• PDBsum: 2fkz
• PubMed: 16584178
• UniProt: P22759|BFR_AZOVI Bacterioferritin (Gene Name=bfr)