Structure of PDB 4r6n Chain E Binding Site BS03

Receptor Information
>4r6n Chain E (length=133) Species: 3490 (Artocarpus integer) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITG
FTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Ligand information
>4r6n Chain H (length=15) Species: 3490 (Artocarpus integer) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SGISQTVIVGPWGAK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4r6n Jacalin-carbohydrate interactions: distortion of the ligand molecule as a determinant of affinity.
Resolution1.67 Å
Binding residue
(original residue number in PDB)
N105 P107 I108 E109 N110 L133
Binding residue
(residue number reindexed from 1)
N105 P107 I108 E109 N110 L133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0019862 IgA binding
GO:0030246 carbohydrate binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4r6n, PDBe:4r6n, PDBj:4r6n
PDBsum4r6n
PubMed25664742
UniProtP18670|LECA_ARTIN Agglutinin alpha chain

[Back to BioLiP]