Structure of PDB 3jcs Chain E Binding Site BS03

Receptor Information
>3jcs Chain E (length=190) Species: 5661 (Leishmania donovani) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVKVKSLCTLQIPEGVTVDVKGRKVTVTGKRGTLTKDLTHLQLDLRVDKK
NRTFTVIRWFGSKIPIACLNTTKAHVQNMITGVTKGYRFKVRCAYAHFPI
NVSVDGQNIEVRNFLGEKRVRRQLVPSSVKVSQTDPSKVKDEIIFDGNDL
EQVSREAAVLHQMCLVKKKDIRKFLDGIYVQTKTNIEGME
Ligand information
>3jcs Chain 4 (length=149) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguaucgugagggaaguaugggguaguaaacucccaugccgugccucuag
uuucugggguuugucgaacggcaagugccccgaagccaucgcacgguggu
ucucggcugaacucuaagccagaagccaaucccaagaccagaugcccac
<<<<<<.<..<<<<.<<<<<<<<........>>>>>>>><<<<<...<.<
<....<<<<<<<<<......>>>>..>>>>>...>>.>..>>>>>.<<<<
<.<.<<<<........>>>>.>.>>>>>.>>>>>......>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jcs 2.8- angstrom Cryo-EM Structure of the Large Ribosomal Subunit from the Eukaryotic Parasite Leishmania.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		H40 A67 C68 N70 T71 A74 H75 A94 Y95 A96 H97 F98 L115 E117 K118 R119 L150 E151 R155 A158 H161 Q162 F174 L175 D176 K183
Binding residue
(residue number reindexed from 1)		H40 A67 C68 N70 T71 A74 H75 A94 Y95 A96 H97 F98 L115 E117 K118 R119 L150 E151 R155 A158 H161 Q162 F174 L175 D176 K183
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jcs, PDBe:3jcs, PDBj:3jcs
PDBsum3jcs
PubMed27373148
UniProtA0A3S7WWL2

[Back to BioLiP]