Structure of PDB 4v95 Chain DG Binding Site BS03

Receptor Information

>4v95 Chain DG (length=180) Species: 300852 (Thermus thermophilus HB8)

LDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARI
LEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIF
LEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDAL
RGMDIAVVTTAETDEEARALLELLGFPFRK

Ligand information

>4v95 Chain DB (length=120)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

.<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4v95 Structural basis for the rescue of stalled ribosomes: structure of YaeJ bound to the ribosome.
• Resolution: 3.2 Å
• Binding residue (original residue number in PDB): N27 V28 W29 E30 Q66 K67 A69 V70 R72 R91 V92 T93 R95 R96 R98
• Binding residue (residue number reindexed from 1): N25 V26 W27 E28 Q64 K65 A67 V68 R70 R89 V90 T91 R93 R94 R96

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v95, PDBe:4v95, PDBj:4v95
• PDBsum: 4v95
• PubMed: 22422986
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)