Structure of PDB 9fh9 Chain D Binding Site BS03

Receptor Information
>9fh9 Chain D (length=91) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
>9fh9 Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcggatgtatatatctgacacgtgcctggagactagggagtaatcccctt
ggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9fh9 Real-space refinement in PHENIX for cryo-EM and crystallography.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		K31 E32 S33 I36 Y37
Binding residue
(residue number reindexed from 1)		K1 E2 S3 I6 Y7
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:9fh9, PDBe:9fh9, PDBj:9fh9
PDBsum9fh9
PubMed39143240
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]